PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA8G00305
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 333aa    MW: 37762.1 Da    PI: 8.0033
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA8G00305genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.6e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l d++ ++G+g +W + + + g++R++k+c++rw++yl
        AA8G00305 14 RGPWSPEEDSKLRDYIDKFGNGgNWISLPLKAGLRRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding42.81.2e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +++  G++ W+ Ia++++ gRt++++k++w++
        AA8G00305  69 GDFSEEEDRIICSLFTAIGSR-WSIIAAHLP-GRTDNDIKNYWNT 111
                      689******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.293962IPR017930Myb domain
SuperFamilySSF466891.18E-2612109IPR009057Homeodomain-like
SMARTSM007172.8E-101364IPR001005SANT/Myb domain
PfamPF002494.0E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-231569IPR009057Homeodomain-like
CDDcd001671.89E-71662No hitNo description
PROSITE profilePS5129422.79763117IPR017930Myb domain
SMARTSM007172.8E-1267115IPR001005SANT/Myb domain
PfamPF002491.2E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2370118IPR009057Homeodomain-like
CDDcd001671.37E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGRAPCCDKT KVKRGPWSPE EDSKLRDYID KFGNGGNWIS LPLKAGLRRC GKSCRLRWLN  60
YLRPNIKHGD FSEEEDRIIC SLFTAIGSRW SIIAAHLPGR TDNDIKNYWN TKLRKKLISS  120
SSSSSPHINP NSQNNIKQPL TTTNPLSSYH PFAENISETP RRSLISNING FEADQEQQIL  180
NFTNPNYPLD NNNNTNYFSD LMNGKRSAEM MLKQEEMMMM MLNLGGYSNI EHHDDDNMDQ  240
RTKGYFGDIT EEYFNNYYYG HGDLKQMISG TGTNCNMNIM NMNMCGSSSS SLSSSTSTSS  300
SSISNLADQN NKSSSSSSLL QHKCLPYFHS YTF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009126579.11e-134PREDICTED: transcription factor RAX1
SwissprotQ9FG681e-127RAX1_ARATH; Transcription factor RAX1
TrEMBLA0A078F8261e-134A0A078F826_BRANA; BnaA02g06100D protein
TrEMBLM4DUN51e-134M4DUN5_BRARP; Uncharacterized protein
STRINGBra020228.1-P1e-133(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM140131623
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23000.11e-106myb domain protein 37